PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G15510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 276aa    MW: 31184.2 Da    PI: 8.4804
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G15510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.21.7e-2657107151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                   kri+n++nrqvtfskRr g++KKA EL vLCda+v +i+fs tg+ly+++s
  OB04G15510.1  57 KRIDNTTNRQVTFSKRRGGLMKKARELAVLCDADVGLIVFSCTGRLYDFAS 107
                   79***********************************************86 PP

2K-box73.84.8e-251302191099
         K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                    +++a+ +q+e++ L+++++nL +++R++lGe+L++ ++++Lq L++q+e sl +iR++K++ll e+i el +k   +q+en +Lrkk++
  OB04G15510.1 130 PTSEAKFWQREVTTLRQQVQNLHQNNRQILGEELSNFTIRDLQLLQNQVEMSLHSIRKTKDQLLAEEILELNQKGSVVQKENIELRKKFD 219
                   567899*********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.42749109IPR002100Transcription factor, MADS-box
SMARTSM004328.5E-3949108IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-3250139IPR002100Transcription factor, MADS-box
CDDcd002651.04E-4250124No hitNo description
PRINTSPR004041.1E-275171IPR002100Transcription factor, MADS-box
PROSITE patternPS00350051105IPR002100Transcription factor, MADS-box
PfamPF003195.9E-2558105IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-277186IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-2786107IPR002100Transcription factor, MADS-box
PfamPF014862.7E-24131218IPR002487Transcription factor, K-box
PROSITE profilePS5129714.104134224IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MAPSVLQIYA ERNVGRRLAG EERSGPLNLS SANLGGGSIA GKIREVEEMG RGKIAIKRID  60
NTTNRQVTFS KRRGGLMKKA RELAVLCDAD VGLIVFSCTG RLYDFASSSM KSIIERYQEA  120
GEEHCRLLNP TSEAKFWQRE VTTLRQQVQN LHQNNRQILG EELSNFTIRD LQLLQNQVEM  180
SLHSIRKTKD QLLAEEILEL NQKGSVVQKE NIELRKKFDI AHQHNIELHK KLKYGESSSG  240
EQATSTNSKD PGESSTRRDS HVHIDLEMSQ KGLEDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-2249124176Myocyte-specific enhancer factor 2B
1tqe_Q6e-2249124176Myocyte-specific enhancer factor 2B
1tqe_R6e-2249124176Myocyte-specific enhancer factor 2B
1tqe_S6e-2249124176Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029270.0AK102927.1 Oryza sativa Japonica Group cDNA clone:J033114E21, full insert sequence.
GenBankAY1776950.0AY177695.2 Oryza sativa (japonica cultivar-group) transcription factor MADS25 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652165.11e-168PREDICTED: MADS-box transcription factor 25
SwissprotQ84NC51e-144MAD25_ORYSJ; MADS-box transcription factor 25
TrEMBLJ3LWM60.0J3LWM6_ORYBR; Uncharacterized protein
STRINGOB04G15510.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.12e-80AGAMOUS-like 16